General Information

  • ID:  hor003045
  • Uniprot ID:  Q8K1M5
  • Protein name:  Neuropeptide W-23
  • Gene name:  NPW
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Neuropeptide B/W family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WYKHVASPRYHTVGRASGLLMGL
  • Length:  23
  • Propeptide:  MDLSALASSREVRGPGPGAPVNRPLLPLLLLLLLLPLPASAWYKHVASPRYHTVGRASGLLMGLRRSPYLWRRALGGAAGPLVGLPGQMARSALLLPSPGQELWEVRSRSSPAGLPVHATRSLRDLEGAGQPEQSLSFQSWTSAEPAARAFGETLRAQPWFLQQIIFADPVRLDDRLKNRWRPRA
  • Signal peptide:  MDLSALASSREVRGPGPGAPVNRPLLPLLLLLLLLPLPASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a regulatory role in the organization of neuroendocrine signals accessing the anterior pituitary gland. Stimulates water drinking and food intake. May play a role in the hypothalamic response to stress. When injected into the lateral cerebroventricle, it elevates prolactin (PRL) and corticosterone and lowers growth hormone (GH) release.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npbwr1
  • Target Unid:  Q56UD9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9LH43-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9LH43-F1.pdbhor003045_AF2.pdbhor003045_ESM.pdb

Physical Information

Mass: 299263 Formula: C119H183N35O29S
Absent amino acids: CDEFINQ Common amino acids: GL
pI: 10.65 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 8
Hydrophobicity: -11.3 Boman Index: -2040
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 84.78
Instability Index: 2050.87 Extinction Coefficient cystines: 8480
Absorbance 280nm: 385.45

Literature

  • PubMed ID:  NA
  • Title:  NA